PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001328m
Common NameCARUB_v10001328mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 346aa    MW: 38878.8 Da    PI: 4.941
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001328mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++l+ +++++G g W+ I+++ g++R++k+c++rw +yl
  Carubv10001328m 14 KGAWTTEEDKKLISYIHEHGEGGWRDIPQKAGLKRCGKSCRLRWANYL 61
                     79********************************************97 PP

2Myb_DNA-binding46.68e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ eE+++++ +++  G++ W+ Iar+++ +Rt++++k++w+++l
  Carubv10001328m  67 RGEFSYEEEQIIIMLHASRGNK-WSVIARHLP-KRTDNEIKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129423.985965IPR017930Myb domain
SuperFamilySSF466897.91E-2911108IPR009057Homeodomain-like
SMARTSM007175.5E-141363IPR001005SANT/Myb domain
PfamPF002492.2E-171461IPR001005SANT/Myb domain
CDDcd001676.13E-111661No hitNo description
Gene3DG3DSA:1.10.10.605.2E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129418.87366116IPR017930Myb domain
SMARTSM007172.5E-1366114IPR001005SANT/Myb domain
PfamPF002491.9E-1367112IPR001005SANT/Myb domain
CDDcd001675.66E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009611Biological Processresponse to wounding
GO:0009625Biological Processresponse to insect
GO:0009682Biological Processinduced systemic resistance
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0050832Biological Processdefense response to fungus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MSRKPCCVGE GLKKGAWTTE EDKKLISYIH EHGEGGWRDI PQKAGLKRCG KSCRLRWANY  60
LKPDIKRGEF SYEEEQIIIM LHASRGNKWS VIARHLPKRT DNEIKNYWNT HLKKRLIDQG  120
IDPVTHKPLA YNNNPGTPPK SSDSQDDEQS QSGSMSPKSL PPPSSSYNLQ ETSSSDETPR  180
YGASLTSKKH LFKRSSSTSK LLNKVAARAA SIGNILSASM EGNLNNSKPL PSCLNDDFSD  240
TSDQLQMDNY DPFSQSSEDI IPDDISMINT ELDKYDFSQF LEQYSNKEGD NFGGYNQDLL  300
MSDVSSTSID EYDIMQNITG WSNYLVDDSD FSYDTNQDCD DKNSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-24121162105C-Myb DNA-Binding Domain
1mse_C1e-24121162105C-Myb DNA-Binding Domain
1a5j_A2e-24121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3507130.0AY350713.1 Capsella rubella clone BAC Cr33L6, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288096.10.0hypothetical protein CARUB_v10001328mg
SwissprotQ9FLR10.0MYB29_ARATH; Transcription factor MYB29
TrEMBLR0GVT90.0R0GVT9_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.6__738__AT5G07690.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37871860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07690.10.0myb domain protein 29